Web stats for Rdmpvtltd - rdmpvtltd.com
4.67 Rating by ClearWebStats
rdmpvtltd.com is 3 years 4 months 4 days old. This website has a #3,553,630 rank in global traffic. It has a .com as an domain extension. This domain is estimated value of $ 240.00 and has a daily earning of $ 1.00. While no active threats were reported recently by users, rdmpvtltd.com is SAFE to browse.
Traffic Report of Rdmpvtltd
Daily Unique Visitors: | 135 |
Daily Pageviews: | 270 |
Estimated Valuation
Income Per Day: | $ 1.00 |
Estimated Worth: | $ 240.00 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Privacy: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Google Pagerank: | Not Applicable |
Alexa Rank: | 3,553,630 |
Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
Not Applicable
Where is rdmpvtltd.com server located?
Social Engagement
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 2 | H2 Headings: | 6 |
H3 Headings: | 6 | H4 Headings: | Not Applicable |
H5 Headings: | 12 | H6 Headings: | 1 |
Total IFRAMEs: | Not Applicable | Total Images: | 21 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 162.241.148.33)
Shri Vishwakarma Safety Training Institute – Safety & Skill Development Institute
- shrivishwakarmasafetytraininginstitute.com
The Shine English Academy – DREAM | LEARN | SPEAK
- theshineenglishacademy.com
Urvashi International Packers and Movers|Movers and Packers Hyderabad
- urvashiinternationalpackers.com
Packers and Movers in Hyderabad - Get best price quotes from Packers and Movers in Hyderabad, Movers and Packers in Hyderabad, Packers & Movers in Hyderabad also Get Quote by Hyderabad Packers and Movers from Hyderabad Packers and Movers
247 Best Pill Pharma – Order Prescription Drugs in our Online shop
- 247bestpillpharma.com
HTTP Header Analysis
HTTP/2 200
date: Wed, 30 Dec 2020 16:46:59 GMT
server: Apache
link: <https://rdmpvtltd.com/wp-json/>; rel="https://api.w.org/", <https://rdmpvtltd.com/wp-json/wp/v2/pages/86>; rel="alternate"; type="application/json", <https://rdmpvtltd.com/>; rel=shortlink
vary: Accept-Encoding
content-encoding: gzip
content-type: text/html; charset=UTF-8
date: Wed, 30 Dec 2020 16:46:59 GMT
server: Apache
link: <https://rdmpvtltd.com/wp-json/>; rel="https://api.w.org/", <https://rdmpvtltd.com/wp-json/wp/v2/pages/86>; rel="alternate"; type="application/json", <https://rdmpvtltd.com/>; rel=shortlink
vary: Accept-Encoding
content-encoding: gzip
content-type: text/html; charset=UTF-8
Domain Information for rdmpvtltd.com
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
rdmpvtltd.com | A | 14397 |
IP:162.241.148.33 |
rdmpvtltd.com | NS | 86400 |
Target:ns2.bh-ht-17.webhostbox.net |
rdmpvtltd.com | NS | 86400 |
Target:ns1.bh-ht-17.webhostbox.net |
rdmpvtltd.com | SOA | 86400 |
MNAME:ns1.bh-ht-17.webhostbox.net RNAME:sampurnraj100.gmail.com Serial:2020122502 Refresh:86400 Retry:7200 Expire:3600000 |
rdmpvtltd.com | MX | 14400 |
Target:mail.rdmpvtltd.com |
rdmpvtltd.com | TXT | 14400 |
TXT:v=spf1 a mx include:websitewelcome.com ~all |
Similarly Ranked Websites to Rdmpvtltd
Preschool Activities, Daycare Forms, Child Care Menus
- ccvillage.com
CCVillage membership includes preschool activities, pre-k printables, child care business forms and child food menus. Free forum for caregivers of preschoolers, toddlers, infants... . .
Cahiers 3 : le défi de la dématérialisation
- les-cahiers-connexions-solidaires.fr
Dématérialisation des services publics : relever le défi.
Mbelos | Free Download Software, Games & Android Apps
- mbelos.com
Mbelos - Free download Software, Game and Android Apps, Full Crack & Full Version. Free download on Mbelos.com
Full WHOIS Lookup for rdmpvtltd.com
Domain Name: RDMPVTLTD.COM
Registry Domain ID: 2580539353_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.registrar.eu
Registrar URL: http://www.openprovider.com
Updated Date: 2020-12-24T06:38:19Z
Creation Date: 2020-12-23T20:53:06Z
Registry Expiry Date: 2021-12-23T20:53:06Z
Registrar: Hosting Concepts B.V. d/b/a Registrar.eu
Registrar IANA ID: 1647
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +31.104482297
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.BH-HT-17.WEBHOSTBOX.NET
Name Server: NS2.BH-HT-17.WEBHOSTBOX.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2020-12-30T16:46:49Z
Registry Domain ID: 2580539353_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.registrar.eu
Registrar URL: http://www.openprovider.com
Updated Date: 2020-12-24T06:38:19Z
Creation Date: 2020-12-23T20:53:06Z
Registry Expiry Date: 2021-12-23T20:53:06Z
Registrar: Hosting Concepts B.V. d/b/a Registrar.eu
Registrar IANA ID: 1647
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +31.104482297
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.BH-HT-17.WEBHOSTBOX.NET
Name Server: NS2.BH-HT-17.WEBHOSTBOX.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2020-12-30T16:46:49Z